missing translation for 'onlineSavingsMsg'
Learn More

GDF-9 Antibody (53/1), mFluor Violet 450 SE, Novus Biologicals™

Product Code. 18423976 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18423976 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18423976 Supplier Novus Biologicals Supplier No. NBP261934MFV450

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry
TRUSTED_SUSTAINABILITY

Specifications

Antigen GDF-9
Applications Western Blot, ELISA, Immunohistochemistry
Classification Monoclonal
Clone 53/1
Conjugate mFluor Violet 450 SE
Dilution Western Blot, ELISA, Immunohistochemistry
Formulation 50mM Sodium Borate
Gene Alias GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Host Species Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2661
Target Species Human
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.