missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18348688

Novus Biologicals™ GDF-8/Myostatin Antibody (3E7), Novus Biologicals™

Product Code. 18348688 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348688 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348688 Supplier Novus Biologicals™ Supplier No. H00002660M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

GDF-8/Myostatin Monoclonal antibody specifically detects GDF-8/Myostatin in Human,Rat samples. It is validated for Western Blot,ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen GDF-8/Myostatin
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3E7
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005250
Gene Alias GDF-8, GDF8growth differentiation factor 8, growth/differentiation factor 8, Myostatin
Host Species Mouse
Immunogen GDF8 (NP_005250, 241 a.a. ∽ 310 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2660
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.