missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCSH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-87493
This item is not returnable.
View return policy
Description
GCSH Polyclonal specifically detects GCSH in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GCSH | |
| Polyclonal | |
| Unconjugated | |
| GCE, glycine cleavage system H protein, mitochondrial, glycine cleavage system protein H (aminomethyl carrier), lipoic acid-containing protein, mitochondrial glycine cleavage system H-protein, NKH | |
| The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2653 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction