missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GCS1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GCS1 Polyclonal specifically detects GCS1 in Human samples. It is validated for Western Blot.Specifications
| GCS1 | |
| Polyclonal | |
| Rabbit | |
| NP_006293 | |
| 7841 | |
| Synthetic peptide directed towards the N terminal of human GCS1The immunogen for this antibody is GCS1. Peptide sequence GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| GCS1, glucosidase I, mannosyl-oligosaccharide glucosidase, processing A-glucosidase I | |
| MOGS | |
| IgG | |
| 92 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title