missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18328729

GCM1 Antibody (3D3), Novus Biologicals™

Product Code. 18328729 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328729 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328729 Supplier Novus Biologicals Supplier No. H00008521M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

GCM1 Monoclonal antibody specifically detects GCM1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen GCM1
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 3D3
Conjugate Unconjugated
Dilution Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003634
Gene Alias GCM motif protein 1, GCMA, glial cells missing (Drosophila) homolog a, Glial cells missing homolog 1, glial cells missing homolog 1 (Drosophila), hGCMachorion-specific transcription factor GCMa
Host Species Mouse
Immunogen GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8521
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.