missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GCLM Polyclonal antibody specifically detects GCLM in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | GCLM |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20-1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | Gamma-ECS regulatory subunit, Gamma-glutamylcysteine synthetase regulatory subunit, GCS light chain, GLCLRglutamate--cysteine ligase regulatory subunit, glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD), Glutamate--cysteine ligase modifier subunit, glutamate-cysteine ligase regulatory protein, glutamate-cysteine ligase, modifier subunit, GSC light chain |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVE |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?