missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCFC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | GCFC2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
GCFC2 Polyclonal specifically detects GCFC2 in Human samples. It is validated for Western Blot.Specifications
| GCFC2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C2orf3, chromosome 2 open reading frame 3, DNABF, GC bindng factor, GCF, GCFGC binding factor, GC-rich sequence DNA-binding factor, GC-rich sequence DNA-binding factor 2, TCF9, TCF-9, Transcription factor 9, transcription factor 9 (binds GC-rich sequences) | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human GCFC2 (NP_003194). Peptide sequence SEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQEDEKQDTWEQQ | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 6936 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title