GBL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-38491

Product Code. 18134999

Description

GBL Polyclonal specifically detects GBL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GBL
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BVC4
• Gene Symbols: MLST8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSP
• Quantity: 0.1 mL
• Research Discipline: Cancer, Hypoxia, mTOR Pathway
• Gene ID (Entrez): 64223
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G protein beta subunit-like, Gable, GbetaL, GBLPop3, Lst8, LST8MGC111011, Mammalian lethal with SEC13 protein 8, mLST8, MTOR associated protein, LST8 homolog (S. cerevisiae), POP3, Protein GbetaL, target of rapamycin complex subunit LST8, TORC subunit LST8, WAT1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.