GBE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18455021	Novus Biologicals NBP1-85875-25ul	25 μL
18224476	Novus Biologicals NBP1-85875	0.1 mL

Description

GBE1 Polyclonal specifically detects GBE1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GBE1
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Rat
• Gene Alias: 1,4-alpha-glucan-branching enzyme, amylo-(1,4 to 1,6) transglucosidase, amylo-(1,4 to 1,6) transglycosylase, Brancher enzyme, EC 2.4.1.18, GBE, glucan (1,4-alpha), branching enzyme 1, glycogen branching enzyme, Glycogen-branching enzyme
• Gene Symbols: GBE1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Concentration: 0.1mg/mL
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2632
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only