GATA-5 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP3-10463-100UL

Codice prodotto. 18356694

Descrizione

GATA-5 Polyclonal specifically detects GATA-5 in Mouse samples. It is validated for Western Blot.

Specifica

• Antigen: GATA-5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: bB379O24.1, GATA binding factor-5, GATA binding protein 5, GATA-binding factor 5, GATA-binding protein 5, transcription factor GATA-5
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_032119). Peptide sequence MYQSLALAQSPGQGTYADSGAFLHSSGTGSPVFVAPTRMPSMLPYLPSCE
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140628
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.