missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18388688

GATA-1 Antibody (3G6), Novus Biologicals™

Product Code. 18388688 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18388688 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18388688 Supplier Novus Biologicals Supplier No. H00002623M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

GATA-1 Monoclonal antibody specifically detects GATA-1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen GATA-1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3G6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002040
Gene Alias Eryf1, ERYF1GATA-binding protein 1 (globin transcription factor 1), GATA binding protein 1 (globin transcription factor 1), GATA-1erythroid transcription factor, GATA-binding factor 1, GF-1, GF1globin transcription factor 1, NF-E1 DNA-binding protein, NFE1erythroid transcription factor 1, transcription factor GATA1, XLTT
Host Species Mouse
Immunogen GATA1 (ENSP00000365858, 123 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2623
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.