GAS41 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10887-100UL

Product Code. 18300584

Description

GAS41 Polyclonal specifically detects GAS41 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GAS41
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAS41 (NP_006521). Peptide sequence SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
• Quantity: 100 μg
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 8089
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified