GAPDH-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18424032	Novus Biologicals NBP2-31925-25ul	25 μL
18173235	Novus Biologicals NBP2-31925	0.1 mL

Description

GAPDH-2 Polyclonal specifically detects GAPDH-2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GAPDH-2
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.2.1, EC 1.2.1.12, GAPD2HSD-35, GAPDH2, GAPDH-2glyceraldehyde-3-phosphate dehydrogenase, testis-specific, GAPDS, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic, Spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2, Spermatogenic glyceraldehyde-3-phosphate dehydrogenase
• Gene Symbols: GAPDHS
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: O14556
• Gene ID (Entrez): 26330
• Immunogen: This GAPDH-2 antibody was developed against a recombinant protein corresponding to amino acids: KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only