missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Gamma Adaptin Rabbit anti-Human, Mouse, Rat, Clone: 4U2C8, Novus Biologicals™

Gamma Adaptin Rabbit anti-Human, Mouse, Rat, Clone: 4U2C8, Novus Biologicals™

Product Code. 18348603 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348603 100 μg 100µL
18396225 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18348603 Supplier Novus Biologicals Supplier No. NBP315727100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Gamma Adaptin Monoclonal antibody specifically detects Gamma Adaptin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Gamma Adaptin
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 4U2C8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 723-822 of human Gamma Adaptin (O43747). RSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Golgi Apparatus Markers, Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 164
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.