Gamma Adaptin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57633

Product Code. 18284501

Description

Gamma Adaptin Polyclonal specifically detects Gamma Adaptin in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Gamma Adaptin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adapter-related protein complex 1 subunit gamma-1, Adaptor protein complex AP-1 subunit gamma-1, adaptor-related protein complex 1, gamma 1 subunit, ADTGclathrin assembly protein complex 1 gamma large chain, AP-1 complex subunit gamma-1, CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1, Clathrin assembly protein complex 1 gamma-1 large chain, gamma adaptin, gamma1-adaptin, golgi adaptor HA1/AP1 adaptin gamma subunit, Golgi adaptor HA1/AP1 adaptin subunit gamma-1, MGC18255
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 85%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43747
• Gene Symbols: AP1G1
• Immunogen: Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS.
• Quantity: 100 μL
• Research Discipline: Golgi Apparatus Markers, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 164
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.