GALT Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33255-100ul

Product Code. 30229685

Description

GALT Monoclonal antibody specifically detects GALT in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: GALT
• Classification: Monoclonal
• Dilution: Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL
• Gene Alias: EC 2.7.7.12, Gal-1-P uridylyltransferase, galactose-1-phosphate uridyl transferase, galactose-1-phosphate uridylyltransferase, UDP-glucose--hexose-1-phosphate uridylyltransferase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GALT (P07902).,, Sequence:, MSRSGTDPQQRQQASEADAAAATFRANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFP
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 2592
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified