missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GALP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-84951-0.1ML
This item is not returnable.
View return policy
Description
GALP Polyclonal specifically detects GALP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| GALP | |
| Polyclonal | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 85569 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| alarin, galanin-like peptide, gal-like peptide | |
| The immunogen is a synthetic peptide directed towards the following sequence VLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKP | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction