missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GALNTL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17371-25UL
This item is not returnable.
View return policy
Description
GALNTL4 Polyclonal antibody specifically detects GALNTL4 in Human samples. It is validated for Immunofluorescence
Specifications
| GALNTL4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| EC 2.4.1.41, GalNAc-T15, GalNAc-T-like protein 4, GalNAc-transferase 18, GALNT15, GALNT18, MGC71806, Polypeptide GalNAc transferase-like protein 4, pp-GaNTase-like protein 4, Protein-UDP acetylgalactosaminyltransferase-like protein 4, putative polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHW | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 374378 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction