GALNTL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59681

Product Code. 18284984

Description

GALNTL4 Polyclonal specifically detects GALNTL4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GALNTL4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.41, GalNAc-T15, GalNAc-T-like protein 4, GalNAc-transferase 18, GALNT15, GALNT18, MGC71806, Polypeptide GalNAc transferase-like protein 4, pp-GaNTase-like protein 4, Protein-UDP acetylgalactosaminyltransferase-like protein 4, putative polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 69 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6P9A2
• Gene Symbols: GALNT18
• Immunogen: Synthetic peptides corresponding to GALNTL4(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 4) The peptide sequence was selected from the middle region of GALNTL4. Peptide sequence IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 374378
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG