missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABPB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £484.00
Specifications
| Antigen | GABPB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18282765
|
Novus Biologicals
NBP2-55876 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630838
|
Novus Biologicals
NBP2-55876-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GABPB1 Polyclonal specifically detects GABPB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| GABPB1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit beta-2, NRF2B1, NRF2B2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53 | |
| GABPB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2553 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title