missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABPB1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33509-100ul
This item is not returnable.
View return policy
Description
GABPB1 Monoclonal antibody specifically detects GABPB1 in Human samples. It is validated for ELISA,Western Blot
Specifications
| GABPB1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit beta-2, NRF2B1, NRF2B2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 290-395 of human GABPB1 (NP_005245.2).,, Sequence:, TSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2553 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction