missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-B R1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | GABA-B R1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18408911
|
Novus Biologicals
NBP2-14033 |
0.1 mL |
£488.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18430482
|
Novus Biologicals
NBP2-14033-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GABA-B R1 Polyclonal antibody specifically detects GABA-B R1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GABA-B R1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2550 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ92613, GABABR1, GABBR1-3, gamma-aminobutyric acid (GABA) B receptor, 1, gamma-aminobutyric acid type B receptor subunit 1, GB1, GPRC3Asubunit 1c, hGB1a, seven transmembrane helix receptor | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title