missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R beta 2 Rabbit anti-Human, Mouse, Rat, Clone: 6G9O8, Novus Biologicals™
Shop All Bio Techne ProductsDescription
GABA-A R beta 2 Monoclonal antibody specifically detects GABA-A R beta 2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | GABA-A R beta 2 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6G9O8 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | GABA(A) receptor subunit beta-2, gamma-aminobutyric acid (GABA) A receptor, beta 2, gamma-aminobutyric acid A receptor beta 2, gamma-aminobutyric acid receptor subunit beta-2, MGC119386, MGC119388, MGC119389 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA-A R beta 2 (GABRB2) (P47870).PYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?