missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R beta 2 Rabbit anti-Human, Mouse, Rat, Clone: 6G9O8, Novus Biologicals™
Shop All Bio Techne ProductsDescription
GABA-A R beta 2 Monoclonal antibody specifically detects GABA-A R beta 2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifikationer
Specifikationer
| Antigen | GABA-A R beta 2 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 6G9O8 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | GABA(A) receptor subunit beta-2, gamma-aminobutyric acid (GABA) A receptor, beta 2, gamma-aminobutyric acid A receptor beta 2, gamma-aminobutyric acid receptor subunit beta-2, MGC119386, MGC119388, MGC119389 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABA-A R beta 2 (GABRB2) (P47870).PYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKIFYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDP |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?