missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GAB1 Rabbit anti-Human, Mouse, Rat, Clone: 9F7T4, Novus Biologicals™

GAB1 Rabbit anti-Human, Mouse, Rat, Clone: 9F7T4, Novus Biologicals™

Product Code. 18399155 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18399155 20 μg 20µL
18306795 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18399155 Supplier Novus Biologicals Supplier No. NBP31563520UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

GAB1 Monoclonal antibody specifically detects GAB1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen GAB1
Applications Western Blot
Classification Monoclonal
Clone 9F7T4
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 594-694 of human GAB1 (NP_002030.2). PNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Apoptosis, Signal Transduction, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 2549
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.