missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18337228

G gamma7 Antibody, Novus Biologicals™

Product Code. 18337228 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18337228 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18337228 Supplier Novus Biologicals Supplier No. H00002788D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

G gamma7 Polyclonal antibody specifically detects G gamma7 in Human samples. It is validated for Western Blot, Proximity Ligation Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen G gamma7
Applications Western Blot, Proximity Ligation Assay
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_443079.1
Gene Alias FLJ00058, GNGT7, guanine nucleotide binding protein (G protein), gamma 7, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Host Species Rabbit
Immunogen GNG7 (NP_443079.1, 1 a.a. - 68 a.a.) full-length human protein. MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2788
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.