missing translation for 'onlineSavingsMsg'
Learn More

G gamma3 Antibody (1E10-1B5), Novus Biologicals™

Product Code. 18330659 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18330659 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18330659 Supplier Novus Biologicals Supplier No. H00002785M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

G gamma3 Monoclonal antibody specifically detects G gamma3 in Human, Rat samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen G gamma3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1E10-1B5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Alias GNGT3, guanine nucleotide binding protein (G protein), gamma 3, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3, guanine nucleotide-binding protein gamma-3 subunit, NBP gamma-3
Host Species Mouse
Immunogen GNG3 (AAH15563, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLVTYCDAHACEDPLITPVPTSENPFREKKFFCALL
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, GPCR, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2785
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Ascites
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.