FUT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57936

Product Code. 18011364

Description

FUT6 Polyclonal specifically detects FUT6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FUT6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: alpha-(1,3)-fucosyltransferase, EC 2.4.1, FCT3AFuc-TVI, FLJ40754, FT1A, Fucosyltransferase 6, fucosyltransferase 6 (alpha (1,3) fucosyltransferase), Fucosyltransferase VI, FucT-VIEC 2.4.1.65, Galactoside 3-L-fucosyltransferase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2528
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51993
• Gene Symbols: FUT6
• Immunogen: Synthetic peptides corresponding to FUT6(fucosyltransferase 6 (alpha (1,3) fucosyltransferase)) The peptide sequence was selected from the C terminal of FUT6. Peptide sequence YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

For Research Use Only