missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18343508

Novus Biologicals™ Fumarylacetoacetate hydrolase Antibody (3G2), Novus Biologicals™

Product Code. 18343508 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343508 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343508 Supplier Novus Biologicals™ Supplier No. H00002184M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Fumarylacetoacetate hydrolase Monoclonal antibody specifically detects Fumarylacetoacetate hydrolase in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Fumarylacetoacetate hydrolase
Applications ELISA
Classification Monoclonal
Clone 3G2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH02527
Gene Alias beta-diketonase, EC 3.7.1.2, FAA, fumarylacetoacetase, Fumarylacetoacetate hydrolase, fumarylacetoacetate hydrolase (fumarylacetoacetase)
Host Species Mouse
Immunogen FAH (AAH02527.1, 1 a.a. ∽ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2184
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.