FTS Antibody, Novus Biologicals™

Artikelnummer.	Quantity	unitSize
18414642	25ul	25µL
18145690	0.1 mL	0.1mL

Artikelnummer. 18414642 Lieferant Novus Biologicals Lieferanten-Nr. NBP21427925ul

Beschreibung

Rabbit Polyclonal Antibody

FTS Polyclonal specifically detects FTS in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: FTS
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AKT interacting protein, AKT-interacting protein, FLJ13258, Ft1, FTSfused toes homolog (mouse), fused toes (mouse) homolog, fused toes homolog, Fused toes protein homolog
• Gene Symbols: AKTIP
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK
• Purification Method: Affinity Purified
• Quantity: 25ul
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 64400
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only