missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FTO Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | FTO |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18207131
|
Novus Biologicals
NBP2-58941 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695626
|
Novus Biologicals
NBP2-58941-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FTO Polyclonal specifically detects FTO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FTO | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Neuroscience | |
| alpha-ketoglutarate-dependent dioxygenase FTO, EC 1.14.11.-, fat mass and obesity associated, Fat mass and obesity-associated protein, KIAA1752protein fto, MGC5149 | |
| FTO | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 79068 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title