missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FSIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FSIP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FSIP1 Polyclonal specifically detects FSIP1 in Human samples. It is validated for Western Blot.Specifications
| FSIP1 | |
| Polyclonal | |
| Rabbit | |
| Q8NA03 | |
| 161835 | |
| Synthetic peptides corresponding to FSIP1(fibrous sheath interacting protein 1) The peptide sequence was selected from the middle region of FSIP1 (NP_689810). Peptide sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| fibrous sheath interacting protein 1, fibrous sheath-interacting protein 1, FLJ35989 | |
| FSIP1 | |
| IgG | |
| 66 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title