FSD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18408250	Novus Biologicals NBP1-81123-25ul	25ul
18267835	Novus Biologicals NBP1-81123	0.1 mL

Description

FSD1 Polyclonal specifically detects FSD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FSD1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: fibronectin type 3 and SPRY domain containing 1, fibronectin type III and SPRY domain containing 1, fibronectin type III and SPRY domain-containing protein 1, GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1, MGC3213, Microtubule-associated protein GLFND, midline 1-related protein 1, MIR1MID1-related protein 1
• Gene Symbols: FSD1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 79187
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDIKAREKDGKGRTASPINSPARGTPSPKRMPSGRGGRDRFTAE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only