Fructosamine-3-kinase-related Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-39063-25ul

Product Code. 18628595

Description

Fructosamine-3-kinase-related Polyclonal specifically detects Fructosamine-3-kinase-related in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Fructosamine-3-kinase-related
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9HA64
• Gene Symbols: FN3KRP
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMD
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 79672
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.1.-, FLJ12171, FN3KL, FN3K-related protein, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.