missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FRS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | FRS3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FRS3 Polyclonal specifically detects FRS3 in Human samples. It is validated for Western Blot.Specifications
| FRS3 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| FGFR substrate 3, FGFR-signaling adaptor SNT2, fibroblast growth factor receptor substrate 3, FRS2B, FRS2beta, FRS2-beta, SNT2, SNT-2MGC17167, Suc1-associated neurotrophic factor target 2, suc1-associated neurotrophic factor target 2 (FGFR signalling adaptor) | |
| FRS3 | |
| IgG | |
| 54 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O43559 | |
| 10817 | |
| Synthetic peptides corresponding to FRS3(fibroblast growth factor receptor substrate 3) The peptide sequence was selected from the middle region of FRS3. Peptide sequence GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title