missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Frizzled-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | Frizzled-4 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18264663
|
Novus Biologicals
NBP2-57807 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683967
|
Novus Biologicals
NBP2-57807-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Frizzled-4 Polyclonal specifically detects Frizzled-4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Frizzled-4 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway | |
| CD344, CD344 antigen, EVR1, exudative vitreoretinopathy 1, FEVR, frizzled (Drosophila) homolog 4, frizzled homolog 4 (Drosophila), frizzled-4, Fz-4, FZD4S, FzE4, GPCR, hFz4, MGC34390, WNT receptor frizzled-4 | |
| FZD4 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 8322 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title