missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Frequenin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£368.00
Specifications
| Antigen | Frequenin |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Frequenin Polyclonal specifically detects Frequenin in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Frequenin | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp761L1223, FREQFLUP, frequenin (Drosophila) homolog, Frequenin homolog, frequenin homolog (Drosophila), Frequenin-like protein, Frequenin-like ubiquitous protein, NCS-1, neuronal calcium sensor 1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human Frequenin (NP_055101). Peptide sequence EEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGL | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 23413 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title