Learn More
Invitrogen™ Fra1 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595521
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human A375 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
The v-Fos oncogene was initially detected in two independent murine osteosarcoma virus isolates and an avian nephroblastoma virus. Members of the c-Fos gene family, including c-Fos, Fos B, Fra-1 and Fra-2, encode nuclear phosphoproteins that are rapidly and transiently induced by a variety of agents and function as transcriptional regulators for several genes. In contrast to c-Jun proteins, which form homo- and heterodimers that bind to specific DNA response elements, c-Fos proteins are only active as heterodimers with members of the Jun gene family. In addition, selected ATF/CREB family members can form leucine zipper dimers with Fos and Jun. Different dimers exhibit differential specificity and affinity for AP-1 and CRE sites.
Specifications
| Fra1 | |
| Polyclonal | |
| Unconjugated | |
| FOSL1 | |
| AW538199; FOS like 1, AP-1 trancription factor subunit; FOS like 1, AP-1 transcription factor subunit; FOS like antigen 1; Fosl1; FOS-like antigen 1; FOS-like antigen-1; fos-related antigen 1; FRA; Fra1; fra-1; HGNC:13718; LOW QUALITY PROTEIN: fos-related antigen 1 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 8061 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| P15407 | |
| FOSL1 | |
| A synthetic peptide corresponding to a sequence of human FRA1 (QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.