missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FPRL1/FPR2 Antibody, Novus Biologicals™

FPRL1/FPR2 Antibody, Novus Biologicals™

Product Code. 18426851 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18426851 0.1 mL 0.10mL
18491982 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18426851 Supplier Novus Biologicals Supplier No. NBP190180

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

FPRL1/FPR2 Polyclonal antibody specifically detects FPRL1/FPR2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen FPRL1/FPR2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias ALXR, FMLP-R-II, FMLPX, formyl peptide receptor 2, Formyl peptide receptor-like 1RFP, FPR2A, FPRH1FMLP-related receptor I, FPRL1LXA4 receptor, HM63FPRH2, Lipoxin A4 receptor, lipoxin A4 receptor (formyl peptide receptor related), LXA4RFMLP-R-I, N-formyl peptide receptor 2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DTYCTFNFASWGGTPEERLKVAITMLTARG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline GPCR, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 2358
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.