missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18361648

FPRL1/FPR2 Antibody (2G8), Novus Biologicals™

Product Code. 18361648 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18361648 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18361648 Supplier Novus Biologicals Supplier No. H00002358M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

FPRL1/FPR2 Monoclonal antibody specifically detects FPRL1/FPR2 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen FPRL1/FPR2
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2G8
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH29125
Gene Alias ALXR, FMLP-R-II, FMLPX, formyl peptide receptor 2, Formyl peptide receptor-like 1RFP, FPR2A, FPRH1FMLP-related receptor I, FPRL1LXA4 receptor, HM63FPRH2, Lipoxin A4 receptor, lipoxin A4 receptor (formyl peptide receptor related), LXA4RFMLP-R-I, N-formyl peptide receptor 2
Host Species Mouse
Immunogen FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline GPCR, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 2358
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.