missing translation for 'onlineSavingsMsg'
Learn More

FoxP4 Antibody (3B12), Novus Biologicals™

Product Code. 18425399 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18425399 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18425399 Supplier Novus Biologicals Supplier No. H00116113M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

FoxP4 Monoclonal antibody specifically detects FoxP4 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen FoxP4
Applications Western Blot, ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 3B12
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001012426
Gene Alias FKHLA, FLJ40908, FLJ44184, fork head-related protein like A, Fork head-related protein-like A, forkhead box P4, forkhead box protein P4, hFKHLA, winged-helix repressor FOXP4
Host Species Mouse
Immunogen FOXP4 (NP_001012426.1, 586 a.a. ∽ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116113
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.