missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FOXO4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | FOXO4 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18282933
|
Novus Biologicals
NBP2-58083 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678658
|
Novus Biologicals
NBP2-58083-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FOXO4 Polyclonal specifically detects FOXO4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| FOXO4 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| AFX, AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7, Fork head domain transcription factor AFX1, forkhead box O4, forkhead box protein O4, MLLT7MGC120490, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7 | |
| FOXO4 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 4303 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title