missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18325927

FoxM1 Antibody (2H4), Novus Biologicals™

Product Code. 18325927 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18325927 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18325927 Supplier Novus Biologicals Supplier No. H00002305M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

FoxM1 Monoclonal antibody specifically detects FoxM1 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen FoxM1
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 2H4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_973731
Gene Alias FKHL16trident, forkhead box M1, forkhead box protein M1, Forkhead, drosophila, homolog-like 16, forkhead-like 16, Forkhead-related protein FKHL16, Hepatocyte nuclear factor 3 forkhead homolog 11, HFH11FOXM1B, HFH-11M-phase phosphoprotein 2, HNF-3, HNF-3/fork-head homolog 11, INS-1, MPHOSPH2, MPP-2, MPP2MPM-2 reactive phosphoprotein 2, PIG29, TGT3, Transcription factor Trident, TRIDENT, WIN, Winged-helix factor from INS-1 cells
Host Species Mouse
Immunogen FOXM1 (NP_973731, 22 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILIS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Mitotic Regulators
Primary or Secondary Primary
Gene ID (Entrez) 2305
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.