missing translation for 'onlineSavingsMsg'
Learn More

FoxC2 Antibody (2H3), Novus Biologicals™

Product Code. 18363888 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18363888 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18363888 Supplier Novus Biologicals Supplier No. H00002303M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

FoxC2 Monoclonal antibody specifically detects FoxC2 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen FoxC2
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA
Classification Monoclonal
Clone 2H3
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 10μg/mL, Immunohistochemistry-Paraffin, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005242
Gene Alias FKHL14LD, forkhead box C2 (MFH-1, mesenchyme forkhead 1), forkhead, Drosophila, homolog-like 14, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, mesenchyme forkhead 1, MFH-1, MFH-1 protein, MFH1forkhead box protein C2, Transcription factor FKH-14
Host Species Mouse
Immunogen FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2303
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.