missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FOXA3 Antibody (1C6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00003171-M01
This item is not returnable.
View return policy
Description
FOXA3 Monoclonal antibody specifically detects FOXA3 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| FOXA3 | |
| Monoclonal | |
| Unconjugated | |
| NP_004488 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 1C6 | |
| In 1x PBS, pH 7.4 | |
| FKHH3, Fork head-related protein FKH H3, forkhead box A3, Forkhead box protein A3, hepatocyte nuclear factor 3, gamma, hepatocyte nuclear factor 3-gamma, HNF-3G, HNF-3-gamma, HNF3GTCF-3G, MGC10179, TCF3G, Transcription factor 3G | |
| FOXA3 (NP_004488.2, 266 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS | |
| 0.1 mg | |
| Chromatin Research | |
| 3171 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction