missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FosB/G0S3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

FosB/G0S3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Product Code. 18344057 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18344057 25 μg 25µL
18349835 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18344057 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP31091425UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

FosB/G0S3 Polyclonal specifically detects FosB/G0S3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen FosB/G0S3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS buffer, 2% sucrose
Gene Alias activator protein 1, AP-1, DKFZp686C0818, FBJ murine osteosarcoma viral oncogene homolog B, G0S3G0/G1 switch regulatory protein 3, GOS3, GOSB, MGC42291, oncogene FOS-B, protein fosB
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Rat FosB/G0S3 (XP_002725585). Peptide sequence AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 2354
Target Species Human, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.