missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Forkhead box I2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifica
| Antigen | Forkhead box I2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Descrizione
Forkhead box I2 Polyclonal specifically detects Forkhead box I2 in Mouse samples. It is validated for Western Blot.Specifica
| Forkhead box I2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| FLJ46831, forkhead box I2, forkhead box protein I2, homolog of mouse Foxi2 | |
| The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_899016). Peptide sequence FDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSE | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 399823 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto