missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
FOLR1 Monoclonal antibody specifically detects FOLR1 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | FOLR1 |
| Applications | Western Blot |
| Classification | Monoclonal |
| Clone | 3J6W3 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Adult folate-binding protein, FBP, folate binding protein, Folate receptor 1, folate receptor 1 (adult), folate receptor alpha, Folate receptor, adult, FOLR, FR-alpha, KB cells FBP, Ovarian tumor-associated antigen MOv18 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FOLR1 (NP_000793.1). MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?