missing translation for 'onlineSavingsMsg'
Learn More

FNBP1L Antibody (1E6), Novus Biologicals™

Product Code. 18328889 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328889 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328889 Supplier Novus Biologicals Supplier No. H00054874M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

FNBP1L Monoclonal antibody specifically detects FNBP1L in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen FNBP1L
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1E6
Conjugate Unconjugated
Dilution Western Blot, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_060207.2
Gene Alias C1orf39, chromosome 1 open reading frame 39, FLJ20275, formin binding protein 1-like, formin-binding protein 1-like, toca-1, TOCA1Transducer of Cdc42-dependent actin assembly protein 1, transducer of Cdc42-dependent actin assembly 1
Host Species Mouse
Immunogen FNBP1L (NP_060207.2, 175 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LNLRTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 54874
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.