missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ FLVCR Antibody (4B2), Novus Biologicals™

Product Code. 18347799 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18347799 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18347799 Supplier Novus Biologicals™ Supplier No. H00028982M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

FLVCR Monoclonal antibody specifically detects FLVCR in Human samples. It is validated for Flow Cytometry,ELISA,Western Blot,Sandwich ELISA,KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen FLVCR
Applications Flow Cytometry, ELISA, Western Blot, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 4B2
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry, ELISA, Sandwich ELISA, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_054772
Gene Alias ataxia, posterior column 1, with retinitis pigmentosa, AXPC1, feline leukemia virus subgroup C cellular receptor 1, Feline leukemia virus subgroup C receptor, feline leukemia virus subgroup C receptor-related protein 1, FLVCRFLJ33420, hFLVCR, MFSD7B, PCA, PCARP
Host Species Mouse
Immunogen FLVCR (NP_054772, 1 a.a. ∽ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 28982
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.